PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013586213.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family EIL
Protein Properties Length: 614aa    MW: 69641.5 Da    PI: 5.6842
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013586213.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3502.71.8e-153504151353
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                     +el++rmw+d+m+lkrlke+ k+  ++ke  ++a+k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipe+gkpv+gasd+Lr+WW
  XP_013586213.1  50 DELERRMWRDKMRLKRLKEQDKS--GSKEG-VDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREWW 141
                     79*******************98..56898.**************************************************************** PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT- CS
            EIN3  96 kekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdq 190
                     k+kv+fdrngpaaiskyqa+n+i++ +++++     ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+Gke+ww++lgl+kdq
  XP_013586213.1 142 KDKVRFDRNGPAAISKYQAENNIPGVREGSNP-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPNGKEDWWPQLGLPKDQ 235
                     *************************9999977.9************************************************************* PP

                     -.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.XXXX.XXXXXXXXXXXX CS
            EIN3 191 gtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.slrk.qspkvtlsceqk 281
                     g+ pykkphdlkkawkv+vLtavikhm p+i++ir+l+rqsk+lqdkm+akes+++l+++nqee+++++++++  ++ sl+  +s ++ +++ ++
  XP_013586213.1 236 GPAPYKKPHDLKKAWKVGVLTAVIKHMFPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEESLARELYPEscPPvSLSGgGSCSLLMNDCSQ 330
                     *************************************************************************6533655556999********* PP

                     XXXX.XXXXXX.XXXXXXXXXX...............XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
            EIN3 282 edve.gkkeskikhvqavktta...............gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                     +dv+  +ke++  +v++ k ++                 ++ rkrk + ++ ++++  +++ tc++  + + +++ +f d+ns+++++
  XP_013586213.1 331 YDVDgLDKETR-YEVEELKPEKvnfgmaanfpvkeevPSEFMRKRKPN-RDLNAMM-DRTIFTCENTGCAHGDVSRGFLDRNSRDNHQ 415
                     ****6566666.779999998899*********997766777777733.3333343.4458*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048739.4E-13050299No hitNo description
Gene3DG3DSA:1.10.3180.108.1E-75173309IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.75E-60178302IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 614 aa     Download sequence    Send to blast
MMFNEMGMCG NMDFFSPASL GEVDFCPAPT HPEPDSVVDD DYTDDEIDVD ELERRMWRDK  60
MRLKRLKEQD KSGSKEGVDA AKQRQSQEQA RRKKMSRAQD GILKYMLKMM EVCKAQGFVY  120
GIIPENGKPV TGASDNLREW WKDKVRFDRN GPAAISKYQA ENNIPGVREG SNPIGPTPHT  180
LQELQDTTLG SLLSALMQHC DPPQRRFPLE KGVPPPWWPN GKEDWWPQLG LPKDQGPAPY  240
KKPHDLKKAW KVGVLTAVIK HMFPDIAKIR KLVRQSKCLQ DKMTAKESAT WLAIINQEES  300
LARELYPESC PPVSLSGGGS CSLLMNDCSQ YDVDGLDKET RYEVEELKPE KVNFGMAANF  360
PVKEEVPSEF MRKRKPNRDL NAMMDRTIFT CENTGCAHGD VSRGFLDRNS RDNHQFVCPH  420
RDSGLPYGAP SRFHVSEVKP VVGFSQPRPV NSVSQPIDLT GIGVPEDGQK MISELMSMYD  480
RNVQSNQNQT SMVTESQLLQ PTVQNHQEHL QFQGNMVEGS FFEDLNIPNR VNNQMFFQGN  540
NNNSGFKYDT AHTTNNNFEA AHNNASSNRF QLVFDSPPFD MASFDYRDDM SMPGVVGTMD  600
GMQQQKQQDV SIWF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A4e-921773092134Protein ETHYLENE INSENSITIVE 3
4zds_B4e-921773092134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013586213.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0D3CHX30.0A0A0D3CHX3_BRAOL; Uncharacterized protein
STRINGAT3G20770.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21352879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein